Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein automated matches [190465] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189707] (9 PDB entries) |
Domain d3zr0a_: 3zr0 A: [186523] automated match to d1irya_ protein/DNA complex; complexed with 8og, so4 |
PDB Entry: 3zr0 (more details), 1.8 Å
SCOPe Domain Sequences for d3zr0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zr0a_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy wfplllqkkkfhgyfkfqgqdtildytlrevdtv
Timeline for d3zr0a_: