SCOPe 2.02: Domain d3zr0a_: 3zr0 A:

Lineage for d3zr0a_ (3zr0 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189707] (5 PDB entries)

8. Domain d3zr0a_: 3zr0 A: [186523]
   automated match to d1irya_
   protein/DNA complex; complexed with 8og, so4

Details for d3zr0a_

PDB Entry: 3zr0, 1.8 Å

PDB Description: crystal structure of human mth1 in complex with 8-oxo-dgmp

PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d3zr0a_:

Sequence; same for both SEQRES and ATOM records:

>d3zr0a_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d3zr0a_:

• d3zr0a_ first appeared in SCOPe 2.01
  
• d3zr0a_ appears in SCOPe 2.03
  
• d3zr0a_ appears in the current release, SCOPe 2.08