Lineage for d3vhva1 (3vhv A:727-984)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009427Domain d3vhva1: 3vhv A:727-984 [186511]
    Other proteins in same PDB: d3vhva2
    automated match to d1m2za_
    complexed with edo, k, ld1, ld2

Details for d3vhva1

PDB Entry: 3vhv (more details), 1.35 Å

PDB Description: Mineralocorticoid receptor ligand-binding domain with non-steroidal antagonist
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d3vhva1:

Sequence, based on SEQRES records: (download)

>d3vhva1 a.123.1.1 (A:727-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakv
lpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamy
elcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkm
vtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisd
qlpkvesgnvkplyfhrk

Sequence, based on observed residues (ATOM records): (download)

>d3vhva1 a.123.1.1 (A:727-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakv
lpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamy
elcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkm
vtkgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkv
esgnvkplyfhrk

SCOPe Domain Coordinates for d3vhva1:

Click to download the PDB-style file with coordinates for d3vhva1.
(The format of our PDB-style files is described here.)

Timeline for d3vhva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vhva2