Class a: All alpha proteins [46456] (290 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
Domain d3vhva1: 3vhv A:727-984 [186511] Other proteins in same PDB: d3vhva2 automated match to d1m2za_ complexed with edo, k, ld1, ld2 |
PDB Entry: 3vhv (more details), 1.35 Å
SCOPe Domain Sequences for d3vhva1:
Sequence, based on SEQRES records: (download)
>d3vhva1 a.123.1.1 (A:727-984) automated matches {Human (Homo sapiens) [TaxId: 9606]} lstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakv lpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamy elcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkm vtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisd qlpkvesgnvkplyfhrk
>d3vhva1 a.123.1.1 (A:727-984) automated matches {Human (Homo sapiens) [TaxId: 9606]} lstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakv lpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamy elcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkm vtkgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkv esgnvkplyfhrk
Timeline for d3vhva1: