SCOPe 2.05: Domain d3us5a_: 3us5 A:

Lineage for d3us5a_ (3us5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)

8. Domain d3us5a_: 3us5 A: [186387]
   automated match to d2dita1
   complexed with cl

Details for d3us5a_

PDB Entry: 3us5, 1.38 Å

PDB Description: crystal structure of a rna-binding domain of a poly-u binding splicing factor 60kda (puf60) from homo sapiens at 1.38 a resolution

PDB Compounds: (A:) Poly(U)-binding-splicing factor PUF60

SCOPe Domain Sequences for d3us5a_:

Sequence; same for both SEQRES and ATOM records:

>d3us5a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgssarhmvmqkllrkqestvmvlrnmvdpkdidddlegevteecgkfgavnrviiyqe
kqgeeedaeiivkifvefsiasethkaiqalngrwfagrkvvaevydqerfdnsdlsa

Timeline for d3us5a_:

• d3us5a_ first appeared in SCOPe 2.01
  
• d3us5a_ appears in SCOPe 2.04
  
• d3us5a_ is called d3us5a1 in SCOPe 2.06
  
• d3us5a_ appears in the current release, SCOPe 2.08, called d3us5a1