PDB entry 3us5

View 3us5 on RCSB PDB site
Description: Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.38 A resolution
Class: RNA binding protein
Keywords: Canonical RBD, RRM, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, Partnership for T-Cell Biology, TCELL, RNA BINDING PROTEIN
Deposited on 2011-11-23, released 2012-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.144
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Poly(U)-binding-splicing factor PUF60
  Species: Homo sapiens [TaxId:9606]
  Gene: BC011265, FIR, PUF60, ROBPI, SIAHBP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UHX1 (1-117)
    • leader sequence (0)
  Domains in SCOPe 2.05: d3us5a_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3us5A (A:)
  gsgssarhmvmqkllrkqestvmvlrnmvdpkdidddlegevteecgkfgavnrviiyqe
  kqgeeedaeiivkifvefsiasethkaiqalngrwfagrkvvaevydqerfdnsdlsa