Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries) |
Domain d3uigb_: 3uig B: [186322] automated match to d1e31b_ complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3uig (more details), 2.4 Å
SCOPe Domain Sequences for d3uigb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uigb_ g.52.1.1 (B:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkel egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef eetakkvrraieqlaa
Timeline for d3uigb_: