![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries) |
![]() | Domain d1e31b_: 1e31 B: [45380] complexed with co, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1e31 (more details), 2.71 Å
SCOPe Domain Sequences for d1e31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e31b_ g.52.1.1 (B:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkel egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef eetakkvrraieqlaamd
Timeline for d1e31b_: