SCOPe 2.04: Domain d3uheb_: 3uhe B:

Lineage for d3uheb_ (3uhe B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)

8. Domain d3uheb_: 3uhe B: [186277]
   automated match to d1nxfa_
   complexed with cmo, hem

Details for d3uheb_

PDB Entry: 3uhe, 2.6 Å

PDB Description: hbi (m37v,l73i) co bound

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uheb_:

Sequence; same for both SEQRES and ATOM records:

>d3uheb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitimyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3uheb_:

• d3uheb_ first appeared in SCOPe 2.01
  
• d3uheb_ appears in SCOPe 2.03
  
• d3uheb_ appears in SCOPe 2.05
  
• d3uheb_ appears in the current release, SCOPe 2.08