Lineage for d3ucha_ (3uch A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553529Protein automated matches [190077] (17 species)
    not a true protein
  7. 1553551Species Human (Homo sapiens) [TaxId:9606] [186915] (14 PDB entries)
  8. 1553573Domain d3ucha_: 3uch A: [186226]
    automated match to d1zmfa1

Details for d3ucha_

PDB Entry: 3uch (more details), 2.5 Å

PDB Description: crystal structure of a peptidyl-prolyl cis-trans isomerase e (ppie) from homo sapiens at 2.50 a resolution
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d3ucha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ucha_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gepiakkarsnpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgss
fhriipqfmcqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqf
fltcdktdwldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv

SCOPe Domain Coordinates for d3ucha_:

Click to download the PDB-style file with coordinates for d3ucha_.
(The format of our PDB-style files is described here.)

Timeline for d3ucha_: