| Class b: All beta proteins [48724] (176 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein automated matches [190077] (17 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186915] (14 PDB entries) |
| Domain d3ucha_: 3uch A: [186226] automated match to d1zmfa1 |
PDB Entry: 3uch (more details), 2.5 Å
SCOPe Domain Sequences for d3ucha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ucha_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gepiakkarsnpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgss
fhriipqfmcqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqf
fltcdktdwldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv
Timeline for d3ucha_: