Lineage for d1zmfa1 (1zmf A:139-300)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806745Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 806746Superfamily b.62.1: Cyclophilin-like [50891] (4 families) (S)
  5. 806747Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 806941Protein Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain [141503] (1 species)
    N-terminal domain belongs to the RBD family ((54929))
    N-terminal domain belongs to the RBD family ((54929))
  7. 806942Species Human (Homo sapiens) [TaxId:9606] [141504] (1 PDB entry)
    Uniprot Q9UNP9 138-301
    structure of the N-terminal RBD is known, PDB 2cqb
  8. 806943Domain d1zmfa1: 1zmf A:139-300 [125361]
    automatically matched to 1ZCX A:138-301

Details for d1zmfa1

PDB Entry: 1zmf (more details), 1.88 Å

PDB Description: c domain of human cyclophilin-33(hcyp33)
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOP Domain Sequences for d1zmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmfa1 b.62.1.1 (A:139-300) Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
npqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfmc
qggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdwl
dgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgey

SCOP Domain Coordinates for d1zmfa1:

Click to download the PDB-style file with coordinates for d1zmfa1.
(The format of our PDB-style files is described here.)

Timeline for d1zmfa1: