| Class b: All beta proteins [48724] (174 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (4 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins) |
| Protein Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain [141503] (1 species) N-terminal domain belongs to the RBD family ((54929)) N-terminal domain belongs to the RBD family ((54929)) |
| Species Human (Homo sapiens) [TaxId:9606] [141504] (1 PDB entry) Uniprot Q9UNP9 138-301 structure of the N-terminal RBD is known, PDB 2cqb |
| Domain d1zmfa1: 1zmf A:139-300 [125361] automatically matched to 1ZCX A:138-301 |
PDB Entry: 1zmf (more details), 1.88 Å
SCOP Domain Sequences for d1zmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zmfa1 b.62.1.1 (A:139-300) Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
npqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfmc
qggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdwl
dgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgey
Timeline for d1zmfa1: