SCOPe 2.08: Domain d1zmfa_: 1zmf A:

Lineage for d1zmfa_ (1zmf A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)

8. Domain d1zmfa_: 1zmf A: [125361]
   automated match to d1ak4a_

Details for d1zmfa_

PDB Entry: 1zmf, 1.88 Å

PDB Description: c domain of human cyclophilin-33(hcyp33)

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d1zmfa_:

Sequence; same for both SEQRES and ATOM records:

>d1zmfa_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfmc
qggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdwl
dgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgey

Timeline for d1zmfa_:

• d1zmfa_ first appeared in SCOP 1.73, called d1zmfa1
  
• d1zmfa_ appears in SCOPe 2.07