Lineage for d1zmfa_ (1zmf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2807019Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)
  8. 2807039Domain d1zmfa_: 1zmf A: [125361]
    automated match to d1ak4a_

Details for d1zmfa_

PDB Entry: 1zmf (more details), 1.88 Å

PDB Description: c domain of human cyclophilin-33(hcyp33)
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d1zmfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmfa_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfmc
qggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdwl
dgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgey

SCOPe Domain Coordinates for d1zmfa_:

Click to download the PDB-style file with coordinates for d1zmfa_.
(The format of our PDB-style files is described here.)

Timeline for d1zmfa_: