Lineage for d3u8jc_ (3u8j C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1561827Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. Protein automated matches [190922] (2 species)
    not a true protein
  7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (11 PDB entries)
  8. 1561969Domain d3u8jc_: 3u8j C: [186114]
    automated match to d1uw6a_
    complexed with 09o, nag, so4

Details for d3u8jc_

PDB Entry: 3u8j (more details), 2.35 Å

PDB Description: crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3531 (1-(pyridin-3-yl)-1,4- diazepane)
PDB Compounds: (C:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8jc_ b.96.1.1 (C:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d3u8jc_:

Click to download the PDB-style file with coordinates for d3u8jc_.
(The format of our PDB-style files is described here.)

Timeline for d3u8jc_: