Lineage for d3ty6c_ (3ty6 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045651Species Bacillus anthracis [TaxId:198094] [189742] (1 PDB entry)
  8. 1045654Domain d3ty6c_: 3ty6 C: [186009]
    automated match to d1yyfc1
    complexed with so4

Details for d3ty6c_

PDB Entry: 3ty6 (more details), 2.5 Å

PDB Description: atp-dependent protease hslv from bacillus anthracis str. ames
PDB Compounds: (C:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d3ty6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ty6c_ d.153.1.4 (C:) automated matches {Bacillus anthracis [TaxId: 198094]}
hattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaftlf
emfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviepdd
gilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel

SCOPe Domain Coordinates for d3ty6c_:

Click to download the PDB-style file with coordinates for d3ty6c_.
(The format of our PDB-style files is described here.)

Timeline for d3ty6c_: