SCOPe 2.07: Domain d3twta_: 3twt A:

Lineage for d3twta_ (3twt A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)

8. Domain d3twta_: 3twt A: [185981]
   Other proteins in same PDB: d3twtc2, d3twtd2
   automated match to d1awcb_
   complexed with 2pe, edo, pe8, so4

Details for d3twta_

PDB Entry: 3twt, 1.85 Å

PDB Description: crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1 (chimeric peptide)

PDB Compounds: (A:) tankyrase-2

SCOPe Domain Sequences for d3twta_:

Sequence; same for both SEQRES and ATOM records:

>d3twta_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllqh
gadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeic
klllqhgadptkknrdgntpldlvkdgdtdiqdllr

Timeline for d3twta_:

• d3twta_ first appeared in SCOPe 2.01
  
• d3twta_ appears in SCOPe 2.06
  
• d3twta_ appears in the current release, SCOPe 2.08