Lineage for d3twsa_ (3tws A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612557Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 2612558Protein automated matches [191267] (8 species)
    not a true protein
  7. 2612577Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)
  8. 2612585Domain d3twsa_: 3tws A: [185977]
    automated match to d1awcb_
    complexed with edo, p6g, pe8, so4

Details for d3twsa_

PDB Entry: 3tws (more details), 1.7 Å

PDB Description: crystal structure of arc4 from human tankyrase 2 in complex with peptide from human terf1 (chimeric peptide)
PDB Compounds: (A:) tankyrase-2

SCOPe Domain Sequences for d3twsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twsa_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllqhg
advhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeick
lllqhgadptkknrdgntpldlvkdgdtdiqdllrgd

SCOPe Domain Coordinates for d3twsa_:

Click to download the PDB-style file with coordinates for d3twsa_.
(The format of our PDB-style files is described here.)

Timeline for d3twsa_: