SCOPe 2.04: Domain d3twqb_: 3twq B:

Lineage for d3twqb_ (3twq B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (16 PDB entries)

8. Domain d3twqb_: 3twq B: [185972]
   automated match to d1awcb_
   complexed with gol, so4

Details for d3twqb_

PDB Entry: 3twq, 2.15 Å

PDB Description: Crystal structure of ARC4 from human Tankyrase 2 (apo form)

PDB Compounds: (B:) tankyrase-2

SCOPe Domain Sequences for d3twqb_:

Sequence; same for both SEQRES and ATOM records:

>d3twqb_ d.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr

Timeline for d3twqb_:

• d3twqb_ first appeared in SCOPe 2.01
  
• d3twqb_ appears in SCOPe 2.03
  
• d3twqb_ appears in SCOPe 2.05
  
• d3twqb_ appears in the current release, SCOPe 2.08, called d3twqb1