Lineage for d3twqb_ (3twq B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050794Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1050795Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1050905Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1050906Protein automated matches [191267] (1 species)
    not a true protein
  7. 1050907Species Human (Homo sapiens) [TaxId:9606] [189837] (8 PDB entries)
  8. 1050924Domain d3twqb_: 3twq B: [185972]
    automated match to d1awcb_
    complexed with gol, so4

Details for d3twqb_

PDB Entry: 3twq (more details), 2.15 Å

PDB Description: Crystal structure of ARC4 from human Tankyrase 2 (apo form)
PDB Compounds: (B:) tankyrase-2

SCOPe Domain Sequences for d3twqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twqb_ d.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr

SCOPe Domain Coordinates for d3twqb_:

Click to download the PDB-style file with coordinates for d3twqb_.
(The format of our PDB-style files is described here.)

Timeline for d3twqb_: