Lineage for d3tr4d_ (3tr4 D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1125641Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 1125758Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 1125759Protein automated matches [190523] (4 species)
    not a true protein
  7. 1125762Species Coxiella burnetii [TaxId:227377] [189766] (1 PDB entry)
  8. 1125766Domain d3tr4d_: 3tr4 D: [185922]
    automated match to d1mjxa_
    complexed with mg, mn

Details for d3tr4d_

PDB Entry: 3tr4 (more details), 2 Å

PDB Description: structure of an inorganic pyrophosphatase (ppa) from coxiella burnetii
PDB Compounds: (D:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3tr4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tr4d_ b.40.5.0 (D:) automated matches {Coxiella burnetii [TaxId: 227377]}
vsagkgiddfnviieipanggevkyeydkelgfltvdrfmptsmrypcnygfvpstlaqd
gdpldvlvltpvpvqpgvlmrvralgimkmedeagedskvlavpvvkacrayeaiqslkd
issllldaishfferykdlepnkwakvkgwedkeaakkefeasivrfk

SCOPe Domain Coordinates for d3tr4d_:

Click to download the PDB-style file with coordinates for d3tr4d_.
(The format of our PDB-style files is described here.)

Timeline for d3tr4d_: