Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.0: automated matches [191399] (1 protein) not a true family |
Protein automated matches [190523] (4 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [189766] (1 PDB entry) |
Domain d3tr4c_: 3tr4 C: [185921] automated match to d1mjxa_ complexed with mg, mn |
PDB Entry: 3tr4 (more details), 2 Å
SCOPe Domain Sequences for d3tr4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tr4c_ b.40.5.0 (C:) automated matches {Coxiella burnetii [TaxId: 227377]} lvsagkgiddfnviieipanggevkyeydkelgfltvdrfmptsmrypcnygfvpstlaq dgdpldvlvltpvpvqpgvlmrvralgimkmedeagedskvlavpvvkacrayeaiqslk dissllldaishfferykdlepnkwakvkgwedkeaakkefeasivrf
Timeline for d3tr4c_: