Lineage for d3tq7b_ (3tq7 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509301Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 1509302Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 1509303Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 1509320Protein automated matches [191278] (1 species)
    not a true protein
  7. 1509321Species Human (Homo sapiens) [TaxId:9606] [189882] (1 PDB entry)
  8. 1509322Domain d3tq7b_: 3tq7 B: [185904]
    Other proteins in same PDB: d3tq7a_, d3tq7p_, d3tq7q_
    automated match to d1txqb1

Details for d3tq7b_

PDB Entry: 3tq7 (more details), 2.3 Å

PDB Description: EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 3

SCOPe Domain Sequences for d3tq7b_:

Sequence, based on SEQRES records: (download)

>d3tq7b_ a.245.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elnqqlvdlkltvdglekerdfyfsklrdielicqehesenspvisgiigilyateegfa
ppeddeieehqqedqdey

Sequence, based on observed residues (ATOM records): (download)

>d3tq7b_ a.245.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elnqqlvdlkltvdglekerdfyfsklrdielicqehpvisgiigilyateqdey

SCOPe Domain Coordinates for d3tq7b_:

Click to download the PDB-style file with coordinates for d3tq7b_.
(The format of our PDB-style files is described here.)

Timeline for d3tq7b_: