| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) ![]() |
| Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
| Protein automated matches [191278] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189882] (1 PDB entry) |
| Domain d3tq7b_: 3tq7 B: [185904] Other proteins in same PDB: d3tq7a_, d3tq7p_, d3tq7q_ automated match to d1txqb1 |
PDB Entry: 3tq7 (more details), 2.3 Å
SCOPe Domain Sequences for d3tq7b_:
Sequence, based on SEQRES records: (download)
>d3tq7b_ a.245.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elnqqlvdlkltvdglekerdfyfsklrdielicqehesenspvisgiigilyateegfa
ppeddeieehqqedqdey
>d3tq7b_ a.245.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elnqqlvdlkltvdglekerdfyfsklrdielicqehpvisgiigilyateqdey
Timeline for d3tq7b_: