Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily) alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest |
Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) |
Family d.367.1.0: automated matches [191577] (1 protein) not a true family |
Protein automated matches [191013] (2 species) not a true protein |
Species Chlamydia trachomatis [TaxId:813] [189808] (1 PDB entry) |
Domain d3t7ya_: 3t7y A: [185677] automated match to d3bzpa1 complexed with cl, fmt, na, sin; mutant |
PDB Entry: 3t7y (more details), 2.1 Å
SCOPe Domain Sequences for d3t7ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t7ya_ d.367.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]} tssqikhasavvsapkdiavaigympekykapwiiamgvnlrakriiaeaekygvpimrn vplahqlldegkelkfipettyeavgeillyits
Timeline for d3t7ya_: