SCOPe 2.01: Domain d3t7ya_: 3t7y A:

Lineage for d3t7ya_ (3t7y A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily)
   alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest

4. Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families)

5. Family d.367.1.0: automated matches [191577] (1 protein)
   not a true family

6. Protein automated matches [191013] (2 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [189808] (1 PDB entry)

8. Domain d3t7ya_: 3t7y A: [185677]
   automated match to d3bzpa1
   complexed with cl, fmt, na, sin; mutant

Details for d3t7ya_

PDB Entry: 3t7y, 2.1 Å

PDB Description: Structure of an autocleavage-inactive mutant of the cytoplasmic domain of CT091, the YscU homologue of Chlamydia trachomatis

PDB Compounds: (A:) Yop proteins translocation protein U

SCOPe Domain Sequences for d3t7ya_:

Sequence; same for both SEQRES and ATOM records:

>d3t7ya_ d.367.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}
tssqikhasavvsapkdiavaigympekykapwiiamgvnlrakriiaeaekygvpimrn
vplahqlldegkelkfipettyeavgeillyits

Timeline for d3t7ya_:

• d3t7ya_ is new in SCOPe 2.01-stable
  
• d3t7ya_ appears in SCOPe 2.02
  
• d3t7ya_ appears in the current release, SCOPe 2.08