PDB entry 3t7y

View 3t7y on RCSB PDB site
Description: Structure of an autocleavage-inactive mutant of the cytoplasmic domain of CT091, the YscU homologue of Chlamydia trachomatis
Class: protein transport
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta, self-cleaving, type III secretion system, transmembrane, inner membrane, cytoplasmic domain, PROTEIN TRANSPORT
Deposited on 2011-07-31, released 2011-11-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Yop proteins translocation protein U
    Species: Chlamydia trachomatis [TaxId:813]
    Gene: CT_091, yscU
    Database cross-references and differences (RAF-indexed):
    • Uniprot O84093
      • engineered mutation (14)
    Domains in SCOPe 2.01: d3t7ya_
  • Chain 'B':
    Compound: Yop proteins translocation protein U
    Species: Chlamydia trachomatis [TaxId:813]
    Gene: CT_091, yscU
    Database cross-references and differences (RAF-indexed):
    • Uniprot O84093
      • engineered mutation (14)
    Domains in SCOPe 2.01: d3t7yb_
  • Heterogens: CL, NA, FMT, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3t7yA (A:)
dtssqikhasavvsapkdiavaigympekykapwiiamgvnlrakriiaeaekygvpimr
nvplahqlldegkelkfipettyeavgeillyitsln

    Sequence, based on observed residues (ATOM records): (download) 
    >3t7yA (A:)
tssqikhasavvsapkdiavaigympekykapwiiamgvnlrakriiaeaekygvpimrn
vplahqlldegkelkfipettyeavgeillyits

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3t7yB (B:)
dtssqikhasavvsapkdiavaigympekykapwiiamgvnlrakriiaeaekygvpimr
nvplahqlldegkelkfipettyeavgeillyitsln

    Sequence, based on observed residues (ATOM records): (download) 
    >3t7yB (B:)
tssqikhasavvsapkdiavaigympekykapwiiamgvnlrakriiaeaekygvpimrn
vplahqlldegkelkfipettyeavgeillyits