SCOPe 2.03: Domain d3t3tb_: 3t3t B:

Lineage for d3t3tb_ (3t3t B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.1: Frataxin-like [55388] (3 proteins)
   iron homeostasis proteins
   automatically mapped to Pfam PF01491

6. Protein automated matches [191244] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189711] (9 PDB entries)

8. Domain d3t3tb_: 3t3t B: [185638]
   automated match to d1ly7a_
   complexed with so4

Details for d3t3tb_

PDB Entry: 3t3t, 1.38 Å

PDB Description: 1.38 A structure of human frataxin variant Q148G

PDB Compounds: (B:) Frataxin, mitochondrial

SCOPe Domain Sequences for d3t3tb_:

Sequence; same for both SEQRES and ATOM records:

>d3t3tb_ d.82.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkg
tpnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk

Timeline for d3t3tb_:

• d3t3tb_ first appeared in SCOPe 2.01
  
• d3t3tb_ appears in SCOPe 2.02
  
• d3t3tb_ appears in SCOPe 2.04
  
• d3t3tb_ appears in the current release, SCOPe 2.08