Lineage for d1ly7a_ (1ly7 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422562Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1422599Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 1422600Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 1422601Protein C-terminal domain of frataxin [55389] (2 species)
    protein responsible for Friedreich ataxia
  7. 1422606Species Human (Homo sapiens) [TaxId:9606] [55390] (2 PDB entries)
  8. 1422608Domain d1ly7a_: 1ly7 A: [74339]

Details for d1ly7a_

PDB Entry: 1ly7 (more details)

PDB Description: the solution structure of the the c-terminal domain of frataxin, the protein responsible for friedreich ataxia
PDB Compounds: (A:) frataxin

SCOPe Domain Sequences for d1ly7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly7a_ d.82.2.1 (A:) C-terminal domain of frataxin {Human (Homo sapiens) [TaxId: 9606]}
mdettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkqt
pnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgkd
a

SCOPe Domain Coordinates for d1ly7a_:

Click to download the PDB-style file with coordinates for d1ly7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ly7a_: