Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) |
Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
Protein C-terminal domain of frataxin [55389] (2 species) protein responsible for Friedreich ataxia |
Species Human (Homo sapiens) [TaxId:9606] [55390] (2 PDB entries) |
Domain d1ly7a_: 1ly7 A: [74339] |
PDB Entry: 1ly7 (more details)
SCOPe Domain Sequences for d1ly7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ly7a_ d.82.2.1 (A:) C-terminal domain of frataxin {Human (Homo sapiens) [TaxId: 9606]} mdettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkqt pnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgkd a
Timeline for d1ly7a_: