Lineage for d1ly7a_ (1ly7 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies) Superfamily d.82.2: Frataxin-like [55387] (1 family) 
Family d.82.2.1: Frataxin-like [55388] (2 proteins) 
Protein C-terminal domain of frataxin [55389] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55390] (2 PDB entries) 
Domain d1ly7a_: 1ly7 A: [74339]
Details for d1ly7a_
PDB Entry: 1ly7 (more details)
PDB Description: the solution structure of the the c-terminal domain of frataxin, the protein responsible for friedreich ataxia
SCOP Domain Sequences for d1ly7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ly7a_ d.82.2.1 (A:) C-terminal domain of frataxin {Human (Homo sapiens)}
mdettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkqt
pnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgkd
a
SCOP Domain Coordinates for d1ly7a_:
Click to download the PDB-style file with coordinates for d1ly7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ly7a_:
- d1ly7a_ is new in SCOP 1.61
- d1ly7a_ appears in SCOP 1.63
- d1ly7a_ appears in the current release, SCOPe 2.08, called d1ly7a1
View in 3D