![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.2: Frataxin/Nqo15-like [55387] (2 families) ![]() |
![]() | Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins |
![]() | Protein automated matches [191244] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189711] (9 PDB entries) |
![]() | Domain d3t3tb_: 3t3t B: [185638] automated match to d1ly7a_ complexed with so4 |
PDB Entry: 3t3t (more details), 1.38 Å
SCOPe Domain Sequences for d3t3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3tb_ d.82.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkg tpnkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk
Timeline for d3t3tb_: