SCOPe 2.01: Domain d3sisa_: 3sis A:

Lineage for d3sisa_ (3sis A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)

6. Protein automated matches [190699] (2 species)
   not a true protein

7. Species Porcine rotavirus [TaxId:31578] [189719] (2 PDB entries)

8. Domain d3sisa_: 3sis A: [185416]
   automated match to d1kqra_
   complexed with mn0, mpd, na

Details for d3sisa_

PDB Entry: 3sis, 2.2 Å

PDB Description: crystal structure of porcine crw-8 rotavirus vp8* in complex with aceramido-gm3_gc

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d3sisa_:

Sequence; same for both SEQRES and ATOM records:

>d3sisa_ b.29.1.14 (A:) automated matches {Porcine rotavirus [TaxId: 31578]}
gslldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynl
fgqqvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngtt
pnattgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

Timeline for d3sisa_:

• d3sisa_ is new in SCOPe 2.01-stable
  
• d3sisa_ appears in SCOPe 2.02
  
• d3sisa_ appears in the current release, SCOPe 2.08, called d3sisa1