Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) |
Protein automated matches [190699] (2 species) not a true protein |
Species Porcine rotavirus [TaxId:31578] [189719] (2 PDB entries) |
Domain d3sisa_: 3sis A: [185416] automated match to d1kqra_ complexed with mn0, mpd, na |
PDB Entry: 3sis (more details), 2.2 Å
SCOPe Domain Sequences for d3sisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sisa_ b.29.1.14 (A:) automated matches {Porcine rotavirus [TaxId: 31578]} gslldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynl fgqqvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngtt pnattgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
Timeline for d3sisa_: