SCOPe 2.08: Domain d3sisa1: 3sis A:64-224

Lineage for d3sisa1 (3sis A:64-224)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
   automatically mapped to Pfam PF00426

6. Protein automated matches [190699] (4 species)
   not a true protein

7. Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries)

8. Domain d3sisa1: 3sis A:64-224 [185416]
   Other proteins in same PDB: d3sisa2
   automated match to d1kqra_
   complexed with mn0, mpd, na

Details for d3sisa1

PDB Entry: 3sis, 2.2 Å

PDB Description: crystal structure of porcine crw-8 rotavirus vp8* in complex with aceramido-gm3_gc

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d3sisa1:

Sequence; same for both SEQRES and ATOM records:

>d3sisa1 b.29.1.14 (A:64-224) automated matches {Porcine rotavirus [TaxId: 31578]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

Timeline for d3sisa1:

• d3sisa1 first appeared in SCOPe 2.01, called d3sisa_
  
• d3sisa1 appears in SCOPe 2.07