| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
| Protein automated matches [190699] (4 species) not a true protein |
| Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries) |
| Domain d3sisa1: 3sis A:64-224 [185416] Other proteins in same PDB: d3sisa2 automated match to d1kqra_ complexed with mn0, mpd, na |
PDB Entry: 3sis (more details), 2.2 Å
SCOPe Domain Sequences for d3sisa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sisa1 b.29.1.14 (A:64-224) automated matches {Porcine rotavirus [TaxId: 31578]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
Timeline for d3sisa1: