| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) ![]() |
| Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins) |
| Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries) |
| Domain d1ezta_: 1ezt A: [18541] |
PDB Entry: 1ezt (more details)
SCOP Domain Sequences for d1ezta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezta_ a.91.1.1 (A:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldltn
Timeline for d1ezta_: