Lineage for d1ezta_ (1ezt A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154767Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
  4. 154768Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 154769Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)
  6. 154783Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species)
  7. 154784Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 154788Domain d1ezta_: 1ezt A: [18541]

Details for d1ezta_

PDB Entry: 1ezt (more details)

PDB Description: high-resolution solution structure of free rgs4 by nmr

SCOP Domain Sequences for d1ezta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezta_ a.91.1.1 (A:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldltn

SCOP Domain Coordinates for d1ezta_:

Click to download the PDB-style file with coordinates for d1ezta_.
(The format of our PDB-style files is described here.)

Timeline for d1ezta_: