Lineage for d3sb2b_ (3sb2 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057429Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2057545Protein automated matches [190062] (8 species)
    not a true protein
  7. 2057628Species Herbaspirillum seropedicae [TaxId:757424] [189857] (1 PDB entry)
  8. 2057630Domain d3sb2b_: 3sb2 B: [185329]
    automated match to d1hk9d_
    complexed with gol

Details for d3sb2b_

PDB Entry: 3sb2 (more details), 2.63 Å

PDB Description: crystal structure of the rna chaperone hfq from herbaspirillum seropedicae smr1
PDB Compounds: (B:) Protein hfq

SCOPe Domain Sequences for d3sb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sb2b_ b.38.1.2 (B:) automated matches {Herbaspirillum seropedicae [TaxId: 757424]}
qllqdpflnalrkehvpvsiylvngiklqghvesfdqyvvllrntvtqmvykhaistvvp
aravn

SCOPe Domain Coordinates for d3sb2b_:

Click to download the PDB-style file with coordinates for d3sb2b_.
(The format of our PDB-style files is described here.)

Timeline for d3sb2b_: