SCOPe 2.03: Domain d3s5fa_: 3s5f A:

Lineage for d3s5fa_ (3s5f A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.1: Frataxin-like [55388] (3 proteins)
   iron homeostasis proteins
   automatically mapped to Pfam PF01491

6. Protein automated matches [191244] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189711] (9 PDB entries)

8. Domain d3s5fa_: 3s5f A: [185288]
   automated match to d1ly7a_
   complexed with mg

Details for d3s5fa_

PDB Entry: 3s5f, 1.5 Å

PDB Description: Crystal structure of human frataxin variant W155F

PDB Compounds: (A:) Frataxin, mitochondrial

SCOPe Domain Sequences for d3s5fa_:

Sequence; same for both SEQRES and ATOM records:

>d3s5fa_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkq
tpnkqiflsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk

Timeline for d3s5fa_:

• d3s5fa_ first appeared in SCOPe 2.01
  
• d3s5fa_ appears in SCOPe 2.02
  
• d3s5fa_ appears in SCOPe 2.04
  
• d3s5fa_ appears in the current release, SCOPe 2.08