| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) ![]() |
| Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
| Protein automated matches [191244] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189711] (10 PDB entries) |
| Domain d3s5fa_: 3s5f A: [185288] automated match to d1ly7a_ complexed with mg |
PDB Entry: 3s5f (more details), 1.5 Å
SCOPe Domain Sequences for d3s5fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s5fa_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkq
tpnkqiflsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk
Timeline for d3s5fa_: