Lineage for d3s5fa_ (3s5f A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962266Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2962311Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2962312Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 2962329Protein automated matches [191244] (1 species)
    not a true protein
  7. 2962330Species Human (Homo sapiens) [TaxId:9606] [189711] (10 PDB entries)
  8. 2962339Domain d3s5fa_: 3s5f A: [185288]
    automated match to d1ly7a_
    complexed with mg

Details for d3s5fa_

PDB Entry: 3s5f (more details), 1.5 Å

PDB Description: Crystal structure of human frataxin variant W155F
PDB Compounds: (A:) Frataxin, mitochondrial

SCOPe Domain Sequences for d3s5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s5fa_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkq
tpnkqiflsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgk

SCOPe Domain Coordinates for d3s5fa_:

Click to download the PDB-style file with coordinates for d3s5fa_.
(The format of our PDB-style files is described here.)

Timeline for d3s5fa_: