Lineage for d3s5ea_ (3s5e A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422562Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1422599Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 1422600Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 1422615Protein automated matches [191244] (1 species)
    not a true protein
  7. 1422616Species Human (Homo sapiens) [TaxId:9606] [189711] (9 PDB entries)
  8. 1422619Domain d3s5ea_: 3s5e A: [185287]
    automated match to d1ly7a_
    complexed with mg; mutant

Details for d3s5ea_

PDB Entry: 3s5e (more details), 1.31 Å

PDB Description: Crystal structure of human frataxin variant W155R, one of the Friedreich's ataxia point mutations
PDB Compounds: (A:) Frataxin, mitochondrial

SCOPe Domain Sequences for d3s5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s5ea_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsldettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvink
qtpnkqirlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysg
k

SCOPe Domain Coordinates for d3s5ea_:

Click to download the PDB-style file with coordinates for d3s5ea_.
(The format of our PDB-style files is described here.)

Timeline for d3s5ea_: