Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [189807] (8 PDB entries) |
Domain d3rnnc_: 3rnn C: [185068] automated match to d1mm6a_ complexed with glu, rnn, zn |
PDB Entry: 3rnn (more details), 1.75 Å
SCOPe Domain Sequences for d3rnnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnnc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne qglldklknkwwydkgec
Timeline for d3rnnc_: