Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species) |
Species Pseudomonas sp. [TaxId:320855] [189498] (11 PDB entries) |
Domain d3rn9b_: 3rn9 B: [185044] Other proteins in same PDB: d3rn9a_, d3rn9c_ automated match to d1t0rb_ complexed with 1pe, edo, fe, oh, so4; mutant |
PDB Entry: 3rn9 (more details), 2.8 Å
SCOPe Domain Sequences for d3rn9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rn9b_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]} alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal pdgenaiveaksasryvrqmmgl
Timeline for d3rn9b_: