Lineage for d3riyb1 (3riy B:34-302)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471146Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2471247Protein automated matches [191258] (3 species)
    not a true protein
  7. 2471251Species Human (Homo sapiens) [TaxId:9606] [189817] (4 PDB entries)
  8. 2471253Domain d3riyb1: 3riy B:34-302 [184996]
    Other proteins in same PDB: d3riya2, d3riyb2
    automated match to d2b4ya1
    complexed with nad, zn

Details for d3riyb1

PDB Entry: 3riy (more details), 1.55 Å

PDB Description: sirt5 is an nad-dependent protein lysine demalonylase and desuccinylase
PDB Compounds: (B:) NAD-dependent deacetylase sirtuin-5

SCOPe Domain Sequences for d3riyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3riyb1 c.31.1.5 (B:34-302) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafah
npsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtkn
lleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcg
gllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvae
fntettpatnrfrfhfqgpcgttlpeala

SCOPe Domain Coordinates for d3riyb1:

Click to download the PDB-style file with coordinates for d3riyb1.
(The format of our PDB-style files is described here.)

Timeline for d3riyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3riyb2