Class a: All alpha proteins [46456] (171 folds) |
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) duplication: contains two structural repeats |
Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins) |
Protein Hemocyanin [48058] (2 species) N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48059] (4 PDB entries) |
Domain d1ll1_2: 1ll1 110-379 [18499] Other proteins in same PDB: d1ll1_1, d1ll1_3 complexed with cl, cu |
PDB Entry: 1ll1 (more details), 2.55 Å
SCOP Domain Sequences for d1ll1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ll1_2 a.86.1.1 (110-379) Hemocyanin {Horseshoe crab (Limulus polyphemus)} pvqeifpdkfipsaaineafkkilvdvgnildpeyrlayyredvginahhwhwhlvypst wnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphlthv asgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhgtdi lgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpifynw hrfidnifheykntlk
Timeline for d1ll1_2: