SCOP 1.61: Domain d1ll1_2: 1ll1 110-379

Lineage for d1ll1_2 (1ll1 110-379)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families)

5. Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)

6. Protein Hemocyanin [48058] (2 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48059] (4 PDB entries)

8. Domain d1ll1_2: 1ll1 110-379 [18499]
   Other proteins in same PDB: d1ll1_1, d1ll1_3

Details for d1ll1_2

PDB Entry: 1ll1, 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus

SCOP Domain Sequences for d1ll1_2:

Sequence; same for both SEQRES and ATOM records:

>d1ll1_2 a.86.1.1 (110-379) Hemocyanin {Horseshoe crab (Limulus polyphemus)}
pvqeifpdkfipsaaineafkkilvdvgnildpeyrlayyredvginahhwhwhlvypst
wnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphlthv
asgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhgtdi
lgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpifynw
hrfidnifheykntlk

Timeline for d1ll1_2:

• d1ll1_2 first appeared (with stable ids) in SCOP 1.55
  
• d1ll1_2 appears in SCOP 1.59
  
• d1ll1_2 appears in SCOP 1.63
  
• d1ll1_2 appears in the current release, SCOPe 2.08, called d1ll1a2