Lineage for d3r9ta_ (3r9t A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462189Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)
  8. 2462190Domain d3r9ta_: 3r9t A: [184863]
    automated match to d1duba_
    complexed with bez

Details for d3r9ta_

PDB Entry: 3r9t (more details), 1.75 Å

PDB Description: structure of echa1_1 from mycobacterium paratuberculosis atcc baa-968 / k-10
PDB Compounds: (A:) EchA1_1

SCOPe Domain Sequences for d3r9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9ta_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}
apgalaerrgnvmvitinrpearnainaavsigvgdaleeaqhdpevravvltgagdksf
cagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlvv
aderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinevv
eagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallkse
dakegprafaekrepvwqar

SCOPe Domain Coordinates for d3r9ta_:

Click to download the PDB-style file with coordinates for d3r9ta_.
(The format of our PDB-style files is described here.)

Timeline for d3r9ta_: