SCOPe 2.07: Domain d3r9tb_: 3r9t B:

Lineage for d3r9tb_ (3r9t B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (70 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)

8. Domain d3r9tb_: 3r9t B: [184864]
   automated match to d1duba_
   complexed with bez

Details for d3r9tb_

PDB Entry: 3r9t, 1.75 Å

PDB Description: structure of echa1_1 from mycobacterium paratuberculosis atcc baa-968 / k-10

PDB Compounds: (B:) EchA1_1

SCOPe Domain Sequences for d3r9tb_:

Sequence; same for both SEQRES and ATOM records:

>d3r9tb_ c.14.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 1770]}
tdapgalaerrgnvmvitinrpearnainaavsigvgdaleeaqhdpevravvltgagdk
sfcagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdl
vvaderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwgline
vveagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallk
sedakegprafaekrepvwqar

Timeline for d3r9tb_:

• d3r9tb_ first appeared in SCOPe 2.01
  
• d3r9tb_ appears in SCOPe 2.06
  
• d3r9tb_ appears in the current release, SCOPe 2.08