Lineage for d3r93c_ (3r93 C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1121844Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1121993Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 1121994Protein automated matches [191139] (2 species)
    not a true protein
  7. 1121998Species Human (Homo sapiens) [TaxId:9606] [189257] (5 PDB entries)
  8. 1122001Domain d3r93c_: 3r93 C: [184853]
    automated match to d2dnta1
    complexed with unx

Details for d3r93c_

PDB Entry: 3r93 (more details), 2.06 Å

PDB Description: crystal structure of the chromo domain of m-phase phosphoprotein 8 bound to h3k9me3 peptide
PDB Compounds: (C:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3r93c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r93c_ b.34.13.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk

SCOPe Domain Coordinates for d3r93c_:

Click to download the PDB-style file with coordinates for d3r93c_.
(The format of our PDB-style files is described here.)

Timeline for d3r93c_: