Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
Protein automated matches [191139] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189257] (5 PDB entries) |
Domain d3r93c_: 3r93 C: [184853] automated match to d2dnta1 complexed with unx |
PDB Entry: 3r93 (more details), 2.06 Å
SCOPe Domain Sequences for d3r93c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r93c_ b.34.13.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
Timeline for d3r93c_: