Lineage for d3r2sa_ (3r2s A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486526Species Pseudomonas aeruginosa [TaxId:287] [189971] (7 PDB entries)
  8. 1486533Domain d3r2sa_: 3r2s A: [184791]
    automated match to d1sofa1
    complexed with fe, na, so4

Details for d3r2sa_

PDB Entry: 3r2s (more details), 2.1 Å

PDB Description: 2.1A resolution structure of Doubly Soaked FtnA from Pseudomonas aeruginosa (pH 6.0)
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3r2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r2sa_ a.25.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mqghpevidylntlltgelaardqyfihsrmyedwgfsklyerlnhemeeetqhadallr
rilllegtprmrpddihpgttvpemleadlklerhvraalakgialceqhkdfvsrdilk
aqladteedhaywleqqlgliarmglenylqsqi

SCOPe Domain Coordinates for d3r2sa_:

Click to download the PDB-style file with coordinates for d3r2sa_.
(The format of our PDB-style files is described here.)

Timeline for d3r2sa_: