| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [189971] (7 PDB entries) |
| Domain d3r2sa_: 3r2s A: [184791] automated match to d1sofa1 complexed with fe, na, so4 |
PDB Entry: 3r2s (more details), 2.1 Å
SCOPe Domain Sequences for d3r2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r2sa_ a.25.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mqghpevidylntlltgelaardqyfihsrmyedwgfsklyerlnhemeeetqhadallr
rilllegtprmrpddihpgttvpemleadlklerhvraalakgialceqhkdfvsrdilk
aqladteedhaywleqqlgliarmglenylqsqi
Timeline for d3r2sa_: