Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
Species Thermotoga maritima [TaxId:2336] [82270] (3 PDB entries) TM1559 |
Domain d3r13b1: 3r13 B:1-248 [184771] Other proteins in same PDB: d3r13a2, d3r13b2 automated match to d1o0ya_ complexed with act, gol, unl |
PDB Entry: 3r13 (more details), 1.83 Å
SCOPe Domain Sequences for d3r13b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r13b1 c.1.10.1 (B:1-248) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} mieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclearenr fhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadeidmvi nvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagahfvkt stgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgvkivq ggeerygg
Timeline for d3r13b1: