SCOPe 2.06: Domain d3qu6c_: 3qu6 C:

Lineage for d3qu6c_ (3qu6 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
   Pfam PF00605

6. Protein automated matches [191301] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189980] (1 PDB entry)

8. Domain d3qu6c_: 3qu6 C: [184631]
   automated match to d1t2ka_
   complexed with cl, na, zn

Details for d3qu6c_

PDB Entry: 3qu6, 2.3 Å

PDB Description: Crystal structure of IRF-3 DBD free form

PDB Compounds: (C:) IRF3 protein

SCOPe Domain Sequences for d3qu6c_:

Sequence, based on SEQRES records:

>d3qu6c_ a.4.5.23 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatgay
vpgrdkpdlptwkrnfrsamnrkeglrlaedrskdphdphkiyefv

Sequence, based on observed residues (ATOM records):

>d3qu6c_ a.4.5.23 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkedfgifqawaeatgayvpgrdkpdl
ptwkrnfrsamnrkeglrlaedrskdphdphkiyefv

Timeline for d3qu6c_:

• d3qu6c_ first appeared in SCOPe 2.01
  
• d3qu6c_ appears in SCOPe 2.05
  
• d3qu6c_ appears in SCOPe 2.07
  
• d3qu6c_ appears in the current release, SCOPe 2.08