![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins) Pfam PF00605 |
![]() | Protein automated matches [191301] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189980] (1 PDB entry) |
![]() | Domain d3qu6c_: 3qu6 C: [184631] automated match to d1t2ka_ complexed with cl, na, zn |
PDB Entry: 3qu6 (more details), 2.3 Å
SCOPe Domain Sequences for d3qu6c_:
Sequence, based on SEQRES records: (download)
>d3qu6c_ a.4.5.23 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatgay vpgrdkpdlptwkrnfrsamnrkeglrlaedrskdphdphkiyefv
>d3qu6c_ a.4.5.23 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kprilpwlvsqldlgqlegvawvnksrtrfripwkedfgifqawaeatgayvpgrdkpdl ptwkrnfrsamnrkeglrlaedrskdphdphkiyefv
Timeline for d3qu6c_: