SCOPe 2.01: Domain d3qu6b_: 3qu6 B:

Lineage for d3qu6b_ (3qu6 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
   Pfam PF00605

6. Protein automated matches [191301] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189980] (1 PDB entry)

8. Domain d3qu6b_: 3qu6 B: [184630]
   automated match to d1t2ka_
   complexed with cl, na, zn

Details for d3qu6b_

PDB Entry: 3qu6, 2.3 Å

PDB Description: Crystal structure of IRF-3 DBD free form

PDB Compounds: (B:) IRF3 protein

SCOPe Domain Sequences for d3qu6b_:

Sequence, based on SEQRES records:

>d3qu6b_ a.4.5.23 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatgay
vpgrdkpdlptwkrnfrsamnrkeglrlaedrskdphdphkiyefv

Sequence, based on observed residues (ATOM records):

>d3qu6b_ a.4.5.23 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhedfgifqawaeatgayvpgrdkpd
lptwkrnfrsamnrkeglrlaedrskdphdphkiyefv

Timeline for d3qu6b_:

• d3qu6b_ is new in SCOPe 2.01-stable
  
• d3qu6b_ appears in SCOPe 2.02
  
• d3qu6b_ appears in the current release, SCOPe 2.08